E2F-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56716

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (94%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all E2F-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for E2F-1 Antibody - BSA Free

Western Blot: E2F-1 Antibody [NBP2-56716]

Western Blot: E2F-1 Antibody [NBP2-56716]

Western Blot: E2F-1 Antibody [NBP2-56716] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: E2F-1 Antibody [NBP2-56716]

Immunocytochemistry/ Immunofluorescence: E2F-1 Antibody [NBP2-56716]

Immunocytochemistry/Immunofluorescence: E2F-1 Antibody [NBP2-56716] - Staining of human cell line RH-30 shows localization to centrosome.
E2F-1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: E2F-1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: E2F-1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-E2F-1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for E2F-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: E2F-1

E2F1 is encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis.

Long Name

E2F Transcription Factor 1

Alternate Names

E2F1, PBR3, RBAP-1, RBBP-3, RBP3

Gene Symbol

E2F1

Additional E2F-1 Products

Product Documents for E2F-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for E2F-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for E2F-1 Antibody - BSA Free

Customer Reviews for E2F-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review E2F-1 Antibody - BSA Free and earn rewards!

Have you used E2F-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies