E2F-2 Antibody (1H7D6)

Novus Biologicals | Catalog # NBP3-16165

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1H7D6 expressed in HEK293
View all E2F-2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 303-395 of human E2F-2 (Q14209). CPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for E2F-2 Antibody (1H7D6)

Western Blot: E2F-2 Antibody (1H7D6) [NBP3-16165]

Western Blot: E2F-2 Antibody (1H7D6) [NBP3-16165]

Western Blot: E2F-2 Antibody (1H7D6) [NBP3-16165] - Western blot analysis of extracts of various cell lines, using E2F-2 Rabbit mAb (NBP3-16165) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.

Applications for E2F-2 Antibody (1H7D6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: E2F-2

E2F transcription factors are functionally regulated by binding to Rb p110, p107, and p130. E2F2 is regulated by complex formation with Rb p110. E2F family members bind DNA as heterodimers with members of the DP family of polypeptides.

Long Name

E2F Transcription Factor 2

Alternate Names

E2F2

Gene Symbol

E2F2

Additional E2F-2 Products

Product Documents for E2F-2 Antibody (1H7D6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for E2F-2 Antibody (1H7D6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for E2F-2 Antibody (1H7D6)

There are currently no reviews for this product. Be the first to review E2F-2 Antibody (1H7D6) and earn rewards!

Have you used E2F-2 Antibody (1H7D6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies