E2F8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57373

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all E2F8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSV

Reactivity Notes

Mouse 80%, Rat 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for E2F8 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: E2F8 Antibody [NBP2-57373]

Immunocytochemistry/ Immunofluorescence: E2F8 Antibody [NBP2-57373]

Immunocytochemistry/Immunofluorescence: E2F8 Antibody [NBP2-57373] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli.
E2F8 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: E2F8 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: E2F8 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-E2F8 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for E2F8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: E2F8

E2F8 is a gene that codes for a protein that is 867 amino acids long, weighs approximately 94 kDa, that is an atypical E2F transcription factor that helps facilitate with various processes including angiogenesis and the polyploidization of specialized cells, especially those in the placenta and liver. Current studies are being done on diseases and disorders related to this gene including hepatocellular carcinoma. E2F8 has also been shown to have interactions with E2F7, EWSR1, and LZTR1.

Alternate Names

E2F family member 8, E2F transcription factor 8, E2F-8, FLJ23311, transcription factor E2F8

Gene Symbol

E2F8

Additional E2F8 Products

Product Documents for E2F8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for E2F8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for E2F8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review E2F8 Antibody - BSA Free and earn rewards!

Have you used E2F8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies