E4F1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56386

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RHLKSLTPCTEKIRFSVSKDVVVSKEDARAGSGAGAAGLGTATSSVTGEPIETSPVIHLVTDAKGTVIHEVHVQM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for E4F1 Antibody - BSA Free

Western Blot: E4F1 Antibody [NBP2-56386]

Western Blot: E4F1 Antibody [NBP2-56386]

Western Blot: E4F1 Antibody [NBP2-56386] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: E4F1 Antibody [NBP2-56386]

Immunocytochemistry/ Immunofluorescence: E4F1 Antibody [NBP2-56386]

Immunocytochemistry/Immunofluorescence: E4F1 Antibody [NBP2-56386] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
E4F1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: E4F1 Antibody - BSA Free [NBP2-56386]

Chromatin Immunoprecipitation-exo-Seq: E4F1 Antibody - BSA Free [NBP2-56386]

ChIP-Exo-Seq composite graph for Anti-E4F1 (NBP2-56386) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for E4F1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: E4F1

The zinc finger protein encoded by this gene is one of several cellular transcription factors whose DNA-binding activities are regulated through the action of adenovirus E1A. A 50-kDa amino-terminal product is generated from the full-length protein through proteolytic cleavage. The protein is differentially regulated by E1A-induced phosphorylation. The full-length gene product represses transcription from the E4 promoter in the absence of E1A, while the 50-kDa form acts as a transcriptional activator in its presence.

Alternate Names

E4F transcription factor 1p50E4F, E4FMGC99614, EC 6.3.2.-, p120E4F, Putative E3 ubiquitin-protein ligase E4F1, Transcription factor E4F, transcription factor E4F1

Gene Symbol

E4F1

Additional E4F1 Products

Product Documents for E4F1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for E4F1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for E4F1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review E4F1 Antibody - BSA Free and earn rewards!

Have you used E4F1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...