EAPP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82956

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all EAPP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Eapp. Peptide sequence: PALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSEDEFEKEMEAELNS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EAPP Antibody - BSA Free

Western Blot: EAPP Antibody [NBP2-82956]

Western Blot: EAPP Antibody [NBP2-82956]

Western Blot: EAPP Antibody [NBP2-82956] - Host: Rabbit. Target Name: Eapp. Sample Type: Rat Thymus lysates. Antibody Dilution: 1.0ug/ml

Applications for EAPP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EAPP

EAPP encodes a phosphoprotein that interacts with several members of the E2F family of proteins. The protein localizes to the nucleus, and is present throughout the cell cycle except during mitosis. It functions to modulate E2F-regulated transcription and stimulate proliferation. [provided by RefSeq].

Alternate Names

BM036, C14orf11, chromosome 14 open reading frame 11, E2F-associated phosphoprotein, FLJ20578, MGC4957

Gene Symbol

EAPP

Additional EAPP Products

Product Documents for EAPP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EAPP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EAPP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EAPP Antibody - BSA Free and earn rewards!

Have you used EAPP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies