EB3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87319

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all EB3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EB3. Peptide sequence: SKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHET The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EB3 Antibody - BSA Free

Western Blot: EB3 Antibody [NBP2-87319]

Western Blot: EB3 Antibody [NBP2-87319]

Western Blot: EB3 Antibody [NBP2-87319] - Host: Rabbit. Target Name: MAPRE3. Sample Tissue: Human Stomach Tumor. Antibody Dilution: 1.0ug/ml

Applications for EB3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EB3

EB3 is a 282 amino acid homologue of EB1, a protein known to bind APC (adenomatous polyposis coli). It has been shown to bind to tubulin in vitro and microtubules in vivo. Northern blotting shows expressions to be mainly in brain, and to a lesser degree in muscle. EB3 interacts with APCL, a homologue of the tumor suppressor APC, and this interaction may be involved in the stabilization or extension of microtubules.

Alternate Names

EB1 protein family member 3, EB3EBF3-S, End-binding protein 3, microtubule-associated protein RP/EB family member 3, microtubule-associated protein, RP/EB family, member 3, RP3EBF3APC binding protein

Gene Symbol

MAPRE3

Additional EB3 Products

Product Documents for EB3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EB3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EB3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EB3 Antibody - BSA Free and earn rewards!

Have you used EB3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies