Ectodysplasin (EDA) is a type II transmembrane protein belonging to the TNF superfamily. It can be expressed as eight alternatively spliced isoforms that are encoded by the EDA gene. Isoforms of EDA are expressed in cells of ectodermal origin, where they are localized to the cell surface and can be released in a soluble form following cleavage by Furin. The EDA-A1 and EDA-A2 splice variants differ by the deletion of two amino acids in the extracellular domain of EDA-A2. Despite this minor difference, EDA-A1 and EDA-A2 display strong receptor specificity. EDA-A1 binds to EDAR, whereas EDA-A2 binds to XEDAR. EDA-A1 and EDA-A2 are required during development, and loss or mutation of EDA results in abnormal development of hair follicles, sweat glands, and teeth. Mutations in the EDA gene are associated with a group of developmental disorders identified as ectodermal dysplasia type 1.
EDA/Ectodysplasin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-80537
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide directed towards the middle region of human EDA. Peptide sequence HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for EDA/Ectodysplasin Antibody - BSA Free
Western Blot: EDA/Ectodysplasin Antibody [NBP1-80537]
Western Blot: EDA/Ectodysplasin Antibody [NBP1-80537] - HepG2 cell lysate, concentration 0.2-1 ug/ml.Applications for EDA/Ectodysplasin Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: EDA/Ectodysplasin
Additional EDA/Ectodysplasin Products
Product Documents for EDA/Ectodysplasin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for EDA/Ectodysplasin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for EDA/Ectodysplasin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review EDA/Ectodysplasin Antibody - BSA Free and earn rewards!
Have you used EDA/Ectodysplasin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...