EEF1B2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53035

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EEF1B2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EEF1B2(eukaryotic translation elongation factor 1 beta 2) The peptide sequence was selected from the middle region of EEF1B2 (NP_066944). Peptide sequence VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EEF1B2 Antibody - BSA Free

Western Blot: EEF1B2 Antibody [NBP1-53035]

Western Blot: EEF1B2 Antibody [NBP1-53035]

Western Blot: EEF1B2 Antibody [NBP1-53035] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Applications for EEF1B2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
Band seen at ~32 kDa in Western blot.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EEF1B2

EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.

Alternate Names

EEF1B, EEF1B1, EF1B, EF-1-beta, elongation factor 1-beta, eukaryotic translation elongation factor 1 beta 1, eukaryotic translation elongation factor 1 beta 2

Entrez Gene IDs

1933 (Human); 55949 (Mouse)

Gene Symbol

EEF1B2

UniProt

P24534 (Human)

Additional EEF1B2 Products

Product Documents for EEF1B2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EEF1B2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EEF1B2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EEF1B2 Antibody - BSA Free and earn rewards!

Have you used EEF1B2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies