EGR3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82983

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all EGR3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EGR3. Peptide sequence: FCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EGR3 Antibody - BSA Free

Western Blot: EGR3 Antibody [NBP2-82983]

Western Blot: EGR3 Antibody [NBP2-82983]

Western Blot: EGR3 Antibody [NBP2-82983] - WB Suggested Anti-EGR3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HT1080 cell lysate

Applications for EGR3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EGR3

The gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the transcriptional regulation of genes in controling biological rhythm. It may also plays a role in muscle development. (provided by RefSeq)

Alternate Names

early growth response 3, early growth response protein 3, EGR-3, MGC138484, PILOTZinc finger protein pilot

Gene Symbol

EGR3

Additional EGR3 Products

Product Documents for EGR3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EGR3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EGR3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EGR3 Antibody - BSA Free and earn rewards!

Have you used EGR3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies