EI24 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98605

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EI24 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is EI24 - N-terminal region. Peptide sequence ICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EI24 Antibody - BSA Free

Western Blot: EI24 Antibody [NBP1-98605]

Western Blot: EI24 Antibody [NBP1-98605]

Western Blot: EI24 Antibody [NBP1-98605] - Hela Cell Lysate 1.0ug/ml, Gel Concentration: 12%

Applications for EI24 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EI24

This gene has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The protein encoded by this gene contains six putative transmembrane domains and may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in two transcript variants encoding different isoforms.

Alternate Names

EPG4, etoposide induced 2.4 mRNA, p53-induced gene 8 protein, PIG8etoposide-induced protein 2.4 homolog, TP53I8, tumor protein p53 inducible protein 8

Gene Symbol

EI24

UniProt

NP_001007278 (Human)

Additional EI24 Products

Product Documents for EI24 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EI24 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EI24 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EI24 Antibody - BSA Free and earn rewards!

Have you used EI24 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies