eIF2B4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94484

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all eIF2B4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human eIF2B4 (Q9UI10). EMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for eIF2B4 Antibody - Azide and BSA Free

Western Blot: eIF2B4 AntibodyAzide and BSA Free [NBP2-94484]

Western Blot: eIF2B4 AntibodyAzide and BSA Free [NBP2-94484]

Western Blot: eIF2B4 Antibody [NBP2-94484] - Western blot analysis of extracts of various cell lines, using EIF2B4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.
eIF2B4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: eIF2B4 Antibody - Azide and BSA Free [NBP2-94484] -

Immunocytochemistry/ Immunofluorescence: eIF2B4 Antibody - Azide and BSA Free [NBP2-94484] - Immunofluorescence analysis of L929 cells using eIF2B4 Rabbit pAb (A18203) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
eIF2B4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: eIF2B4 Antibody - Azide and BSA Free [NBP2-94484] -

Immunocytochemistry/ Immunofluorescence: eIF2B4 Antibody - Azide and BSA Free [NBP2-94484] - Immunofluorescence analysis of U2OS cells using eIF2B4 Rabbit pAb (A18203) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for eIF2B4 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: eIF2B4

EIF2B4 - eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa

Long Name

Translation initiation factor eIF-2B subunit delta

Alternate Names

DKFZP586J0119, EIF2BD, EIF2Bdelta

Gene Symbol

EIF2B4

Additional eIF2B4 Products

Product Documents for eIF2B4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for eIF2B4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for eIF2B4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review eIF2B4 Antibody - Azide and BSA Free and earn rewards!

Have you used eIF2B4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies