EIF2G Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53087

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EIF2G Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EIF2G (eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa) The peptide sequence was selected from the N terminal of EIF2G. Peptide sequence LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 3.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EIF2G Antibody - BSA Free

Western Blot: EIF2G Antibody [NBP1-53087]

Western Blot: EIF2G Antibody [NBP1-53087]

Western Blot: EIF2G Antibody [NBP1-53087] - Jurkat cell lysate, concentration 5.0ug/ml.

Applications for EIF2G Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF2G

eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.

Alternate Names

EIF2, eIF-2gA, EIF2gamma, eIF-2-gamma X, EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD), eIF-2gX, eukaryotic translation initiation factor 2 subunit 3, Eukaryotic translation initiation factor 2 subunit gamma X, eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa, eukaryotic translation initiation factor 2G

Gene Symbol

EIF2S3

UniProt

P41091 (Human)

Additional EIF2G Products

Product Documents for EIF2G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EIF2G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF2G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF2G Antibody - BSA Free and earn rewards!

Have you used EIF2G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies