eIF3K Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98396

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is Eif3k - N-terminal region. Peptide sequence QILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for eIF3K Antibody - BSA Free

Western Blot: eIF3K Antibody [NBP1-98396]

Western Blot: eIF3K Antibody [NBP1-98396]

Western Blot: eIF3K Antibody [NBP1-98396] - Mouse Liver lysate, concentration 1 ug/ml.

Applications for eIF3K Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eIF3K

Eif3k is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.

Alternate Names

ARG134, eIF3k, EIF3-p28, EIF3S12eIF-3 p28, Eukaryotic translation initiation factor 3 subunit 12, eukaryotic translation initiation factor 3 subunit K, eukaryotic translation initiation factor 3, subunit 12, eukaryotic translation initiation factor 3, subunit K, HSPC029, M9, MSTP001, muscle specific, Muscle-specific gene M9 protein, PLAC24, PLAC-24, PLAC-24eIF-3 p25, PRO1474, PTD001

Gene Symbol

EIF3K

Additional eIF3K Products

Product Documents for eIF3K Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for eIF3K Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for eIF3K Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eIF3K Antibody - BSA Free and earn rewards!

Have you used eIF3K Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...