EIF3M Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56654

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to EIF3M(eukaryotic translation initiation factor 3, subunit M) The peptide sequence was selected from the N terminal of EIF3M. Peptide sequence MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: M.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EIF3M Antibody - BSA Free

Western Blot: EIF3M Antibody [NBP1-56654]

Western Blot: EIF3M Antibody [NBP1-56654]

Western Blot: EIF3M Antibody [NBP1-56654] - HepG2 cell lysate, Antibody Titration: 1.0ug/ml
Immunohistochemistry-Paraffin: EIF3M Antibody [NBP1-56654]

Immunohistochemistry-Paraffin: EIF3M Antibody [NBP1-56654]

Immunohistochemistry-Paraffin: EIF3M Antibody [NBP1-56654] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
EIF3M Antibody

Western Blot: EIF3M Antibody [NBP1-56654] -

TRS functions similarly to eIF4G & acts as an eIF4F analog. a Pull-down assay of co-expressed TRS-Strep with eIF4A- or eIF4G-FLAG in 293 T cells. TRS-Strep was pulled down with Strep-Tactin beads, & co-precipitation of eIF4A or 4 G was determined by immunoblotting with anti-FLAG antibody. EV, empty vector. * indicates a nonspecific band. b Immunoassay of the co-expression of different combinations of plasmids in 293T cells. Myc-TRS was immunoprecipitated with anti-Myc antibody, & co-precipitation of other proteins was determined using tag-specific antibodies. c Immunoassay of co-expressed eIF4A-FLAG with GST-fused full-length TRS or its various domains in 293T cells. eIF4A-FLAG was immunoprecipitated with anti-FLAG antibody, & co-precipitated TRS proteins were determined by immunoblotting with anti-GST antibody. d Pull-down assay of endogenous translation initiation factors with m7GTP-Sepharose beads in 293 T cells transfected with siRNAs against TRS, 4EHP, or a non-targeting control (siCont). Cap-bound proteins were eluted from beads & immunoblotted with the indicated antibodies. Sepharose beads were used as a negative control. e Pull-down assay of endogenous translation initiation factors with m7GTP-Sepharose beads in 293T cells transfected with siRNAs against eIF4G, eIF4E, or siCont, & their suppression effects on cap-binding of other components, were determined as in (d). The data are representative of at least three experiments, each with similar results Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30902983), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
EIF3M Antibody

Western Blot: EIF3M Antibody [NBP1-56654] -

TRS functions similarly to eIF4G & acts as an eIF4F analog. a Pull-down assay of co-expressed TRS-Strep with eIF4A- or eIF4G-FLAG in 293 T cells. TRS-Strep was pulled down with Strep-Tactin beads, & co-precipitation of eIF4A or 4 G was determined by immunoblotting with anti-FLAG antibody. EV, empty vector. * indicates a nonspecific band. b Immunoassay of the co-expression of different combinations of plasmids in 293T cells. Myc-TRS was immunoprecipitated with anti-Myc antibody, & co-precipitation of other proteins was determined using tag-specific antibodies. c Immunoassay of co-expressed eIF4A-FLAG with GST-fused full-length TRS or its various domains in 293T cells. eIF4A-FLAG was immunoprecipitated with anti-FLAG antibody, & co-precipitated TRS proteins were determined by immunoblotting with anti-GST antibody. d Pull-down assay of endogenous translation initiation factors with m7GTP-Sepharose beads in 293 T cells transfected with siRNAs against TRS, 4EHP, or a non-targeting control (siCont). Cap-bound proteins were eluted from beads & immunoblotted with the indicated antibodies. Sepharose beads were used as a negative control. e Pull-down assay of endogenous translation initiation factors with m7GTP-Sepharose beads in 293T cells transfected with siRNAs against eIF4G, eIF4E, or siCont, & their suppression effects on cap-binding of other components, were determined as in (d). The data are representative of at least three experiments, each with similar results Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30902983), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for EIF3M Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF3M

EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].

Alternate Names

B5 receptor, dendritic cell protein, eIF3m, eukaryotic translation initiation factor 3 subunit M, eukaryotic translation initiation factor 3, subunit M, Fetal lung protein B5, FLJ29030, GA17, HFLB5, hFL-B5, PCI domain containing 1 (herpesvirus entry mediator), PCI domain-containing protein 1, PCID1B5

Gene Symbol

EIF3M

UniProt

Additional EIF3M Products

Product Documents for EIF3M Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EIF3M Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for EIF3M Antibody - BSA Free

Customer Reviews for EIF3M Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF3M Antibody - BSA Free and earn rewards!

Have you used EIF3M Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...