EIF3M Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-56654
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to EIF3M(eukaryotic translation initiation factor 3, subunit M) The peptide sequence was selected from the N terminal of EIF3M. Peptide sequence MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: M.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for EIF3M Antibody - BSA Free
Western Blot: EIF3M Antibody [NBP1-56654]
Western Blot: EIF3M Antibody [NBP1-56654] - HepG2 cell lysate, Antibody Titration: 1.0ug/mlImmunohistochemistry-Paraffin: EIF3M Antibody [NBP1-56654]
Immunohistochemistry-Paraffin: EIF3M Antibody [NBP1-56654] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.Western Blot: EIF3M Antibody [NBP1-56654] -
TRS functions similarly to eIF4G & acts as an eIF4F analog. a Pull-down assay of co-expressed TRS-Strep with eIF4A- or eIF4G-FLAG in 293 T cells. TRS-Strep was pulled down with Strep-Tactin beads, & co-precipitation of eIF4A or 4 G was determined by immunoblotting with anti-FLAG antibody. EV, empty vector. * indicates a nonspecific band. b Immunoassay of the co-expression of different combinations of plasmids in 293T cells. Myc-TRS was immunoprecipitated with anti-Myc antibody, & co-precipitation of other proteins was determined using tag-specific antibodies. c Immunoassay of co-expressed eIF4A-FLAG with GST-fused full-length TRS or its various domains in 293T cells. eIF4A-FLAG was immunoprecipitated with anti-FLAG antibody, & co-precipitated TRS proteins were determined by immunoblotting with anti-GST antibody. d Pull-down assay of endogenous translation initiation factors with m7GTP-Sepharose beads in 293 T cells transfected with siRNAs against TRS, 4EHP, or a non-targeting control (siCont). Cap-bound proteins were eluted from beads & immunoblotted with the indicated antibodies. Sepharose beads were used as a negative control. e Pull-down assay of endogenous translation initiation factors with m7GTP-Sepharose beads in 293T cells transfected with siRNAs against eIF4G, eIF4E, or siCont, & their suppression effects on cap-binding of other components, were determined as in (d). The data are representative of at least three experiments, each with similar results Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30902983), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: EIF3M Antibody [NBP1-56654] -
TRS functions similarly to eIF4G & acts as an eIF4F analog. a Pull-down assay of co-expressed TRS-Strep with eIF4A- or eIF4G-FLAG in 293 T cells. TRS-Strep was pulled down with Strep-Tactin beads, & co-precipitation of eIF4A or 4 G was determined by immunoblotting with anti-FLAG antibody. EV, empty vector. * indicates a nonspecific band. b Immunoassay of the co-expression of different combinations of plasmids in 293T cells. Myc-TRS was immunoprecipitated with anti-Myc antibody, & co-precipitation of other proteins was determined using tag-specific antibodies. c Immunoassay of co-expressed eIF4A-FLAG with GST-fused full-length TRS or its various domains in 293T cells. eIF4A-FLAG was immunoprecipitated with anti-FLAG antibody, & co-precipitated TRS proteins were determined by immunoblotting with anti-GST antibody. d Pull-down assay of endogenous translation initiation factors with m7GTP-Sepharose beads in 293 T cells transfected with siRNAs against TRS, 4EHP, or a non-targeting control (siCont). Cap-bound proteins were eluted from beads & immunoblotted with the indicated antibodies. Sepharose beads were used as a negative control. e Pull-down assay of endogenous translation initiation factors with m7GTP-Sepharose beads in 293T cells transfected with siRNAs against eIF4G, eIF4E, or siCont, & their suppression effects on cap-binding of other components, were determined as in (d). The data are representative of at least three experiments, each with similar results Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30902983), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for EIF3M Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
1:10-1:500
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: EIF3M
Alternate Names
B5 receptor, dendritic cell protein, eIF3m, eukaryotic translation initiation factor 3 subunit M, eukaryotic translation initiation factor 3, subunit M, Fetal lung protein B5, FLJ29030, GA17, HFLB5, hFL-B5, PCI domain containing 1 (herpesvirus entry mediator), PCI domain-containing protein 1, PCID1B5
Gene Symbol
EIF3M
UniProt
Additional EIF3M Products
Product Documents for EIF3M Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for EIF3M Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for EIF3M Antibody - BSA Free
Customer Reviews for EIF3M Antibody - BSA Free
There are currently no reviews for this product. Be the first to review EIF3M Antibody - BSA Free and earn rewards!
Have you used EIF3M Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...