EIF4E3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82987

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all EIF4E3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EIF4E3. Peptide sequence: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EIF4E3 Antibody - BSA Free

Western Blot: EIF4E3 Antibody [NBP2-82987]

Western Blot: EIF4E3 Antibody [NBP2-82987]

Western Blot: EIF4E3 Antibody [NBP2-82987] - Host: Rabbit. Target Name: EIF4E3. Sample Tissue: Human DLD1. Antibody Dilution: 1.0ug/ml

Applications for EIF4E3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF4E3

EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure ofmRNA and recruit mRNA to the ribosome (Joshi et al., 2004 (PubMed 15153109)).(supplied by OMIM)

Alternate Names

eIF4E type 3, eIF-4E type 3, eIF-4E3, eIF4E-3, eukaryotic translation initiation factor 4E family member 3, eukaryotic translation initiation factor 4E member 3, eukaryotic translation initiation factor 4E type 3, MGC39820, MGC86971

Gene Symbol

EIF4E3

Additional EIF4E3 Products

Product Documents for EIF4E3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EIF4E3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF4E3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF4E3 Antibody - BSA Free and earn rewards!

Have you used EIF4E3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies