ELOVL5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59539

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ELOVL5(ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)) The peptide sequence was selected from the N terminal of ELOVL5. Peptide sequence EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ELOVL5 Antibody - BSA Free

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.
Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - Jurkat, Antibody Dilution: 1.0 ug/ml ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - MCF7, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7.

Applications for ELOVL5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ELOVL5

ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011

Alternate Names

dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast)

Gene Symbol

ELOVL5

UniProt

Additional ELOVL5 Products

Product Documents for ELOVL5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ELOVL5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ELOVL5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ELOVL5 Antibody - BSA Free and earn rewards!

Have you used ELOVL5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...