ELOVL5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59539

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ELOVL5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ELOVL5(ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)) The peptide sequence was selected from the N terminal of ELOVL5. Peptide sequence EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ELOVL5 Antibody - BSA Free

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.
Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - Jurkat, Antibody Dilution: 1.0 ug/ml ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539]

Western Blot: ELOVL5 Antibody [NBP1-59539] - MCF7, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7.

Applications for ELOVL5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ELOVL5

ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011

Alternate Names

dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast)

Gene Symbol

ELOVL5

UniProt

Q9NYP7 (Human)

Additional ELOVL5 Products

Product Documents for ELOVL5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ELOVL5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ELOVL5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ELOVL5 Antibody - BSA Free and earn rewards!

Have you used ELOVL5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies