Elp4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10631

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Elp4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Elp4. Peptide sequence TMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIR

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Elp4 Antibody - BSA Free

Western Blot: Elp4 Antibody [NBP3-10631]

Western Blot: Elp4 Antibody [NBP3-10631]

Western Blot: Elp4 Antibody [NBP3-10631] - Western blot analysis of Elp4 in Fetal Heart lysates. Antibody dilution at 1.0ug/ml

Applications for Elp4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Elp4

Elp4 encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.

Alternate Names

C11orf19, chromosome 11 open reading frame 19, dJ68P15A.1, elongation protein 4 homolog (S. cerevisiae), elongator complex protein 4, hELP4, PAX6 neighbor gene protein, PAX6NEB, PAXNEBFLJ20498

Gene Symbol

ELP4

Additional Elp4 Products

Product Documents for Elp4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Elp4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Elp4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Elp4 Antibody - BSA Free and earn rewards!

Have you used Elp4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies