EME1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55350

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EME1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EME1(essential meiotic endonuclease 1 homolog 1 (S. pombe)) The peptide sequence was selected from the middle region of EME1. Peptide sequence AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EME1 Antibody - BSA Free

Western Blot: EME1 Antibody [NBP1-55350]

Western Blot: EME1 Antibody [NBP1-55350]

Western Blot: EME1 Antibody [NBP1-55350] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Applications for EME1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EME1

EME1 interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. EME1 may be required in mitosis for the processing of stalled or collapsed replication forks.EME1 and MUS81 (MIM 606591) form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication (Abraham et al., 2003 [PubMed 14609959]).[supplied by OMIM].

Alternate Names

crossover junction endonuclease EME1, EC 3.1.22, EC 3.1.22.-, essential meiotic endonuclease 1 homolog 1 (S. pombe), essential meiotic endonuclease 1 homolog 2, FLJ31364, hMMS4, homolog of yeast EME1 endonuclease, MMS4, MMS4 homolog, MMS4L, SLX2 structure-specific endonuclease subunit homolog A, SLX2A

Gene Symbol

EME1

UniProt

Q96AY2 (Human)

Additional EME1 Products

Product Documents for EME1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EME1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EME1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EME1 Antibody - BSA Free and earn rewards!

Have you used EME1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies