EN1/Engrailed 1 Antibody (3B4K8)

Novus Biologicals | Catalog # NBP3-15852

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3B4K8 expressed in HEK293
View all Engrailed-1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 293-392 of human EN1/Engrailed 1 (Q05925). KLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EN1/Engrailed 1 Antibody (3B4K8)

Western Blot: EN1/Engrailed 1 Antibody (3B4K8) [NBP3-15852]

Western Blot: EN1/Engrailed 1 Antibody (3B4K8) [NBP3-15852]

Western Blot: EN1/Engrailed 1 Antibody (3B4K8) [NBP3-15852] - Analysis of extracts of various cell lines, using EN1/Engrailed 1 Rabbit mAb (NBP3-15852) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Western Blot: EN1/Engrailed 1 Antibody (3B4K8) [NBP3-15852]

Western Blot: EN1/Engrailed 1 Antibody (3B4K8) [NBP3-15852]

Western Blot: EN1/Engrailed 1 Antibody (3B4K8) [NBP3-15852] - Analysis of extracts of SH-SY5Y cells, using EN1/Engrailed 1 Rabbit mAb (NBP3-15852) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for EN1/Engrailed 1 Antibody (3B4K8)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Engrailed-1

Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.

Alternate Names

EN1, Engrailed1

Gene Symbol

EN1

Additional Engrailed-1 Products

Product Documents for EN1/Engrailed 1 Antibody (3B4K8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EN1/Engrailed 1 Antibody (3B4K8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EN1/Engrailed 1 Antibody (3B4K8)

There are currently no reviews for this product. Be the first to review EN1/Engrailed 1 Antibody (3B4K8) and earn rewards!

Have you used EN1/Engrailed 1 Antibody (3B4K8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies