engrailed homeobox 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35750

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Engrailed-2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 250-333 of human engrailed homeobox 2 (NP_001418.2).

Sequence:
AFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for engrailed homeobox 2 Antibody - BSA Free

engrailed homeobox 2 Antibody

Western Blot: engrailed homeobox 2 Antibody [NBP3-35750] -

Western Blot: engrailed homeobox 2 Antibody [NBP3-35750] - Western blot analysis of various lysates using engrailed homeobox 2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for engrailed homeobox 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Engrailed-2

EN1 and EN2 encode homeodomain containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. EN2 may play a role in susceptibility to autism spectrum disorders.

Alternate Names

EN2, Engrailed2

Gene Symbol

EN2

Additional Engrailed-2 Products

Product Documents for engrailed homeobox 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for engrailed homeobox 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for engrailed homeobox 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review engrailed homeobox 2 Antibody - BSA Free and earn rewards!

Have you used engrailed homeobox 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies