Ephrin-A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68860

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ephrin-A2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG

Reactivity Notes

Mouse 88%, Rat 88%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ephrin-A2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Ephrin-A2 Antibody [NBP2-68860]

Immunocytochemistry/ Immunofluorescence: Ephrin-A2 Antibody [NBP2-68860]

Immunocytochemistry/Immunofluorescence: Ephrin-A2 Antibody [NBP2-68860] - Staining of human cell line Hep G2 shows localization to cytosol & mitochondria.

Applications for Ephrin-A2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ephrin-A2

The Eph subfamily represents the largest group of receptor protein kinases identified to date. There is increasing evidence that Eph family members are involved in central nervous system function and in development. Ligands for Eph receptors include ephrin-A1 (LERK-1/B61), identified as a ligand for the EphA2 (Eck) receptor; ephrin-A2 (ELF-1), identified as a ligand for the EphA3 and EphA4 (Sek) receptors; ephrin-A3 (LERK-3), identified as a ligand for EphA5 (Ehk1) and EphA3 (Hek) receptors; ephrin-A4 (LERK-4), identified as a ligand for the EphA3 receptor; ephrin-A5 (AL-1), identified as a ligand for EphA5 (REK7); ephrin-B1 (LERK-2), identified as a ligand for the EphB1 (Elk) and EphB2 (Cek5) receptors; ephrin-B2 (LERK-5), identified as a ligand for the EphB1, EphB3 (Cek10) and EphB2 receptors; and ephrin-B3 (LERK-8), identified as a ligand for EphB1.

Alternate Names

Cek7-L, EFNA2, ELF-1, EphrinA2, LERK6

Gene Symbol

EFNA2

Additional Ephrin-A2 Products

Product Documents for Ephrin-A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ephrin-A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Ephrin Ligands and Eph Receptors

Customer Reviews for Ephrin-A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ephrin-A2 Antibody - BSA Free and earn rewards!

Have you used Ephrin-A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies