Epimorphin/Syntaxin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55283

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Epimorphin/Syntaxin 2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNTIDKITQYVEEVKK

Reactivity Notes

Mouse 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Epimorphin/Syntaxin 2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Epimorphin/Syntaxin 2 Antibody [NBP2-55283]

Immunocytochemistry/ Immunofluorescence: Epimorphin/Syntaxin 2 Antibody [NBP2-55283]

Immunocytochemistry/Immunofluorescence: Epimorphin/Syntaxin 2 Antibody [NBP2-55283] - Staining of human cell line PC-3 shows localization to nucleoplasm.

Applications for Epimorphin/Syntaxin 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Epimorphin/Syntaxin 2

Syntaxin 2, also known as epimorphin, is a 35 kDa type II integral membrane that belongs to the t SNARE family, a group of proteins involved in protein transport. Syntaxin 2 was first identified as a factor that promotes branching morphogenesis in mammary epithelial cells. Studies using pancreatic exocrine acinar cells, in which the exocytic pathways are well defined, show primary localization of syntaxin 2 to the apical plasma membrane. Homologs of syntaxin 2 have been identified in various eukaryotes ranging from yeast to human. Neuronal syntaxin is a component of a 20S complex implicated in vesicle docking and fusion, which involves its interaction with syntaxin through a ATP dependent reaction modulated by synaptotagmin, SNAP 25, alpha SNAP, and NSF.

Alternate Names

STX2, Syntaxin 2

Gene Symbol

STX2

Additional Epimorphin/Syntaxin 2 Products

Product Documents for Epimorphin/Syntaxin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Epimorphin/Syntaxin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Epimorphin/Syntaxin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Epimorphin/Syntaxin 2 Antibody - BSA Free and earn rewards!

Have you used Epimorphin/Syntaxin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies