Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein

Novus Biologicals | Catalog # H00006338-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-640 of Human SCNN1B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRTICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

96.14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00006338-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: epithelial Sodium Channel beta

SCNN1B( AAH36352, 1 a.a. - 641 a.a.) recombinant protein with GST.

Long Name

Amiloride-sensitive sodium channel subunit beta

Alternate Names

Beta-ENaC, Beta-NaCH, ENaCB, SCNEB, SCNN1B

Gene Symbol

SCNN1B

Additional epithelial Sodium Channel beta Products

Product Documents for Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human epithelial Sodium Channel beta GST (N-Term) Protein

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Why are there 2 additional bands on the photo for product H00006338-P01?

    A: The epithelial Sodium Channel beta Recombinant Protein (H00006338-P01) is a product we distribute for a Taiwanese company called Abnova. We do not perform any in-house testing or development of their products. The image that appears on our website is taken from their datasheet showing a 12.5% SDS-PAGE stained with Coomassie Blue. We unfortunately do not have any information regarding the two additional bands seen in the gel. Abnova's recombinant proteins are produced in a cell-free wheat germ system. This protein was made to the full length sequence of human Amiloride-sensitive sodium channel subunit beta (Acc# P51168). The protein also contains a GST tag. See the following link for a description of their production process: http://www.abnova.com/support/Protein.asp

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...