ESRP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58259

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL

Reactivity Notes

Mouse 89%, Rat 87%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ESRP2 Antibody - BSA Free

Western Blot: ESRP2 Antibody [NBP2-58259]

Western Blot: ESRP2 Antibody [NBP2-58259]

Western Blot: ESRP2 Antibody [NBP2-58259] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: ESRP2 Antibody [NBP2-58259]

Immunocytochemistry/ Immunofluorescence: ESRP2 Antibody [NBP2-58259]

Immunocytochemistry/Immunofluorescence: ESRP2 Antibody [NBP2-58259] - Staining of human cell line MCF7 shows localization to nucleoplasm.
ESRP2 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: ESRP2 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: ESRP2 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-ESRP2 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for ESRP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Simple Western

1:50 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ESRP2

ESPR2 is an epithelial cell-type-specific splicing regulator (Warzecha et al., 2009 (PubMed 19285943)).(supplied byOMIM)

Alternate Names

epithelial splicing regulatory protein 2, FLJ21918, FLJ22248, RBM35BRNA-binding protein 35B, RNA binding motif protein 35A, RNA binding motif protein 35B, RNA-binding motif protein 35B

Gene Symbol

ESRP2

Additional ESRP2 Products

Product Documents for ESRP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ESRP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ESRP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ESRP2 Antibody - BSA Free and earn rewards!

Have you used ESRP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...