ESX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80214

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ESX1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of mouse ESX1. Peptide sequence MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ESX1 Antibody - BSA Free

Western Blot: ESX1 Antibody [NBP1-80214]

Western Blot: ESX1 Antibody [NBP1-80214]

Western Blot: ESX1 Antibody [NBP1-80214] - Human Testis lysate, concentration 2.5 ug/ml.

Applications for ESX1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ESX1

The ESX1 gene encodes a 406 amino acid long, 44kDA homeobox protein ESX1 that functions in cell cycle progression and transcription during spermatogenesis and plays a critical role in placental development. ESX1 interacts with genes EXOC2 and TRAP1 and is linked to diseases such as testicular germ cell tumors, delayed puberty, hypopituitarism, tuberculosis, and holoprosencephaly.

Alternate Names

ESX homeobox 1, ESX1LESX1R, ESX1-related protein, ESXR1homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1, extraembryonic, spermatogenesis, homeobox 1 homolog, extraembryonic, spermatogenesis, homeobox 1 homolog (mouse)

Gene Symbol

ESX1

UniProt

NP_031983 (Mouse)

Additional ESX1 Products

Product Documents for ESX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ESX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ESX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ESX1 Antibody - BSA Free and earn rewards!

Have you used ESX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies