ETS1 associated protein II Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55948

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ETS1 associated protein II Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ETS1 associated protein II Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ETS1 associated protein II Antibody [NBP2-55948]

Immunocytochemistry/ Immunofluorescence: ETS1 associated protein II Antibody [NBP2-55948]

Immunocytochemistry/Immunofluorescence: ETS1 associated protein II Antibody [NBP2-55948] - Staining of human cell line HEK 293 shows localization to nucleoplasm, nuclear bodies & aggresome.

Applications for ETS1 associated protein II Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ETS1 associated protein II

Ets proteins constitute a family of conserved sequence-specific DNA-binding proteins and function as transcription factors with roles in differentiation, lymphoid cell development, invasiveness and angiogenesis. A novel ETS1 interacting protein designated as ETS1-associated protein II (EAPII) interacts with ETS1 and other Ets proteins (ETS2 and FLI1) and is a novel ETS1 modulator.

Alternate Names

AD022, dJ30M3.3, EAP2, EAPII, EC 3.1.4.-, ETS1-associated protein 2, ETS1-associated protein II, MGC111021,5'-Tyr-DNA phosphodiesterase, MGC9099,5'-tyrosyl-DNA phosphodiesterase, TRAF and TNF receptor associated protein, TTRAPTRAF and TNF receptor-associated protein, Tyr-DNA phosphodiesterase 2, tyrosyl-DNA phosphodiesterase 2

Gene Symbol

TDP2

Additional ETS1 associated protein II Products

Product Documents for ETS1 associated protein II Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ETS1 associated protein II Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ETS1 associated protein II Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ETS1 associated protein II Antibody - BSA Free and earn rewards!

Have you used ETS1 associated protein II Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies