Evx1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79701

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Evx1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human EVX1The immunogen for this antibody is EVX1. Peptide sequence PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Evx1 Antibody - BSA Free

Western Blot: Evx1 Antibody [NBP1-79701]

Western Blot: Evx1 Antibody [NBP1-79701]

Western Blot: Evx1 Antibody [NBP1-79701] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Applications for Evx1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Evx1

The Evx1 gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as

Alternate Names

eve, even-skipped homeo box homolog 1, eve, even-skipped homeobox homolog 1, eve, even-skipped homeobox homolog 1 (Drosophila), even-skipped homeo box 1 (homolog of Drosophila), even-skipped homeobox 1, EVX-1, homeobox even-skipped homolog protein 1

Gene Symbol

EVX1

UniProt

NP_001980 (Human)

Additional Evx1 Products

Product Documents for Evx1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Evx1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Evx1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Evx1 Antibody - BSA Free and earn rewards!

Have you used Evx1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies