Catalog Number: 1933
Alternate Names: Exenatide, AC 2993
Biological Activity
High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); originally isolated from Heloderma suspectum venom. Potently induces cAMP formation without stimulating amylase release in pancreatic acini. Potentiates glucose-induced insulin secretion in isolated rat islets. Protects against glutamate-induced neurotoxicity.
Technical Data
  • M.Wt:
    4186.61
  • Formula:
    C184H282N50O60S
  • Sequence:
    HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    (Modifications: Ser-39 = C-terminal amide)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    141758-74-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom.
    Eng et al.
    J.Biol.Chem., 1992;267:7402
  2. Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting β-cells.
    Goke et al.
    J.Biol.Chem., 1993;268:19650
  3. Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.
    Thorens et al.
    Diabetes, 1993;42:1678
  4. Protection and reversal of excitotoxic neuronal damage by glucagon-like peptide-1 and exendin-4.
    Perry et al.
    J.Pharmacol.Exp.Ther., 2002;302:881
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Exendin-4 include:

4 Citations: Showing 1 - 4
Filter your results:

  1. GLP-1 acts on habenular avoidance circuits to control nicotine intake.
    Authors: Tuesta
    Nat Neurosci 2017;20(5):708
  2. Gastrin: a distinct fate of neurogenin3 positive progenitor cells in the embryonic pancreas.
    Authors: Suissa Et al.
    ACS Chem Biol 2013;8:e70397
  3. Glucagon-like peptide-1 protects against cardiac microvascular injury in diabetes via a cAMP/PKA/Rho-dependent mechanism.
    Authors: Wang Et al.
    PLoS One 2013;62:1697
  4. Glucagon-like peptide-1 regulation of carbohydrate intake is differentially affected by obesogenic diets.
    Authors: Pritchett and Hajnal
    Obesity (Silver Spring) 2012;20:313

Have you used Exendin-4?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information