Exendin-4

  ( 6 citations )    
Product Datasheet
Catalog Number:1933
Alternate Names:Exenatide, AC 2993
Chemical Name:
Product Details
Citations (6)
Supplemental Products
Reviews
Biological Activity
High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); originally isolated from Heloderma suspectum venom. Potently induces cAMP formation without stimulating amylase release in pancreatic acini. Potentiates glucose-induced insulin secretion in isolated rat islets. Protects against glutamate-induced neurotoxicity.
Technical Data
  • M.Wt:
    4186.61
  • Formula:
    C184H282N50O60S
  • Sequence:
    HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    (Modifications: Ser-39 = C-terminal amide)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    141758-74-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Exendin-4 include:

6 Citations: Showing 1 - 6
Filter your results:

  1. Crystal structure of the GLP-1 receptor bound to a peptide agonist.
    Authors: Jazayeri
    Nature  2017;546:254
  2. GLP-1 acts on habenular avoidance circuits to control nicotine intake.
    Authors: Tuesta
    Nat Neurosci  2017;20(5):708
  3. Novel and ultra-rare damaging variants in neuropeptide signaling are associated with disordered eating behaviors.
    Authors: Lutter
    PLoS One  2017;12(8):e0181556
  4. Gastrin: a distinct fate of neurogenin3 positive progenitor cells in the embryonic pancreas.
    Authors: Suissa Et al.
    ACS Chem Biol  2013;8:e70397
  5. Glucagon-like peptide-1 protects against cardiac microvascular injury in diabetes via a cAMP/PKA/Rho-dependent mechanism.
    Authors: Wang Et al.
    PLoS One  2013;62:1697
  6. Glucagon-like peptide-1 regulation of carbohydrate intake is differentially affected by obesogenic diets.
    Authors: Pritchett and Hajnal
    Obesity (Silver Spring)  2012;20:313

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used Exendin-4?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee