Exendin-4

Catalog # Availability Size / Price Qty
1933/1
Glucagon-Like Peptide 1 Receptor Agonists Peptide
1 Image
Description: Potent GLP-1 receptor agonist
Alternative Names: Exenatide, AC 2993
Product Details
Citations (8)
Supplemental Products
Reviews

Biological Activity

High affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); originally isolated from Heloderma suspectum venom. Potently induces cAMP formation without stimulating amylase release in pancreatic acini. Potentiates glucose-induced insulin secretion in isolated rat islets. Protects against glutamate-induced neurotoxicity.

Technical Data

M.Wt:
4186.61
Formula:
C184H282N50O60S
Sequence:
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

(Modifications: Ser-39 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
141758-74-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Citations for Exendin-4

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Exendin-4

There are currently no reviews for this product. Be the first to review Exendin-4 and earn rewards!

Have you used Exendin-4?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.