EXOC2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83786
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Applications
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for EXOC2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: EXOC2 Antibody [NBP1-83786]
Immunocytochemistry/Immunofluorescence: EXOC2 Antibody [NBP1-83786] - Staining of human cell line U-251 MG shows positivity in vesicles.Western Blot: EXOC2 Antibody - BSA Free [NBP1-83786] -
LAMP2A KO leads to the down-regulation of KFERQ-containing proteins in sEVs.(A) Schematic representation of LAMP2 genomic sequence. There are three isoforms of LAMP2 (A, B, and C) originated by the alternative splicing of exon 9. In red is the exon for the LAMP2A isoform. ARPE-19 cells were cultured in exosome-depleted medium. sEVs were isolated from cell culture supernatants. (B) TEM images show isolated exosomes. Graphs show particle number and size using nanoparticle tracking system (NanoSight). LAMP2A KO maintains particle size and number. (C) WB of cell extracts and sEV fractions blotted with antibodies raised against membrane EV-positive markers (CD63 and LAMP2A), cytosolic EV-positive markers (HSC70 and FLOT1), EV-negative markers [CANX (calnexin) and ATP1A1 (ATPase Na+/K+ Transporting Subunit Alpha 1)], and KFERQ-containing proteins. LAMP2A KO leads to a decrease in the protein levels of EEA1, EXOc2, and histone 3, which contain at least one KFERQ motif each, as well as HSC70. (D) Raw MS/MS fragmentation spectrum of the peptide HHHAGYEQF, exclusively from LAMP2 isoform A, present only in WT samples. (E) Schematic representation shows the rules for the identification of putative KFERQ motifs. Graph shows the percentage of proteins with at least one KFERQ motif in their sequence that is present in sEVs. (F) Heatmaps of down-regulated proteins in sEVs after LAMP2A KO. Down-regulated proteins (67%) contain KFERQ motifs. All samples were analyzed under the same experimental conditions. The results represent means +/- SD of at least n = 3 independent experiments (***P < 0.001 and ****P < 0.0001). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35333565), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for EXOC2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: EXOC2
Alternate Names
exocyst complex component 2, Exocyst complex component Sec5, FLJ11026, SEC5, SEC5L1, SEC5-like 1, SEC5-like 1 (S. cerevisiae), Sec5p
Gene Symbol
EXOC2
Additional EXOC2 Products
Product Documents for EXOC2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for EXOC2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for EXOC2 Antibody - BSA Free
Customer Reviews for EXOC2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review EXOC2 Antibody - BSA Free and earn rewards!
Have you used EXOC2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...