EXOC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87377

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all EXOC2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human EXOC2. Peptide sequence: MLDLDNDTRPSVLGHLSQTASLKRGSSFQSGRDDTWRYKTPHRVAFVEKL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EXOC2 Antibody - BSA Free

Western Blot: EXOC2 Antibody [NBP2-87377]

Western Blot: EXOC2 Antibody [NBP2-87377]

Western Blot: EXOC2 Antibody [NBP2-87377] - Host: Rabbit. Target Name: EXOC2. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for EXOC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EXOC2

The protein encoded by the EXOC2 gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and the functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. This interaction has been shown to mediate filopodia formation in fibroblasts. (provided by RefSeq)

Alternate Names

exocyst complex component 2, Exocyst complex component Sec5, FLJ11026, SEC5, SEC5L1, SEC5-like 1, SEC5-like 1 (S. cerevisiae), Sec5p

Gene Symbol

EXOC2

Additional EXOC2 Products

Product Documents for EXOC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EXOC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EXOC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EXOC2 Antibody - BSA Free and earn rewards!

Have you used EXOC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies