EXOC6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55430

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to EXOC6(exocyst complex component 6) Antibody(against the N terminal of EXOC6. Peptide sequence MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EXOC6 Antibody - BSA Free

Western Blot: EXOC6 Antibody [NBP1-55430]

Western Blot: EXOC6 Antibody [NBP1-55430]

Western Blot: EXOC6 Antibody [NBP1-55430] - Mouse fibroblast lysates, Antibody Titration: 0.2-1 ug/ml
Western Blot: EXOC6 Antibody [NBP1-55430]

Western Blot: EXOC6 Antibody [NBP1-55430]

Western Blot: EXOC6 Antibody [NBP1-55430] - Sample Type: mouse fibroblast lusate (20ug) Primary Dilution: 1:1000 (2% milk) Secondary Dilution: 1:2000 (5% milk)

Applications for EXOC6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EXOC6

The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

DKFZp761I2124, EXOC6A, exocyst complex component 6, Exocyst complex component Sec15A, FLJ1125, FLJ11251, MGC33397, SEC15A, SEC15L1SEC15-like 1 (S. cerevisiae), SEC15L3, SEC15-like 1, SEC15-like protein 1, SEC15-like protein 3, SEC15LSEC15, Sec15p

Gene Symbol

EXOC6

UniProt

Additional EXOC6 Products

Product Documents for EXOC6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EXOC6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EXOC6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EXOC6 Antibody - BSA Free and earn rewards!

Have you used EXOC6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...