EXOD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55303

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EXOD1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ERI2(ERI1 exoribonuclease family member 2) The peptide sequence was selected from the middle region of ERI2 (NP_542394). Peptide sequence LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EXOD1 Antibody - BSA Free

Western Blot: EXOD1 Antibody [NBP1-55303]

Western Blot: EXOD1 Antibody [NBP1-55303]

Western Blot: EXOD1 Antibody [NBP1-55303] - Human 721_B, Antibody Dilution: 1.0 ug/ml ERI2 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: EXOD1 Antibody [NBP1-55303]

Western Blot: EXOD1 Antibody [NBP1-55303]

Western Blot: EXOD1 Antibody [NBP1-55303] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: EXOD1 Antibody [NBP1-55303]

Western Blot: EXOD1 Antibody [NBP1-55303]

Western Blot: EXOD1 Antibody [NBP1-55303] - Human HepG2, Antibody Dilution: 1.0 ug/ml ERI2 is supported by BioGPS gene expression data to be expressed in HepG2.

Applications for EXOD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
In Western blot, recognizes a 37 kDa band.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EXOD1

EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.

Alternate Names

EC 3.1, ERI1 exoribonuclease 2, ERI1 exoribonuclease family member 2, EXOD1, exonuclease domain containing 1, Exonuclease domain-containing protein 1, exoribonuclease 2, KIAA1504enhanced RNAi three prime mRNA exonuclease homolog 2, MGC16943

Entrez Gene IDs

112479 (Human)

Gene Symbol

ERI2

UniProt

A8K979 (Human)

Additional EXOD1 Products

Product Documents for EXOD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EXOD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EXOD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EXOD1 Antibody - BSA Free and earn rewards!

Have you used EXOD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies