Exosome component 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56887

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Exosome component 5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI

Reactivity Notes

Mouse 80%, Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Exosome component 5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Exosome component 5 Antibody [NBP2-56887]

Immunocytochemistry/ Immunofluorescence: Exosome component 5 Antibody [NBP2-56887]

Immunocytochemistry/Immunofluorescence: Exosome component 5 Antibody [NBP2-56887] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Applications for Exosome component 5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Exosome component 5

EXOSC5 is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAscontaining AU-rich elements (AREs) within their 3'-untranslated regions. Required for the 3'-processing of the 7Spre-RNA to the mature 5.8S rRNA. Has

Alternate Names

CML28, exosome complex exonuclease RRP46, exosome component 5Chronic myelogenous leukemia tumor antigen 28, exosome component Rrp46, hRrp46p, MGC12901, p12BMGC111224, RRP41B, Rrp46p, RRP46Ribosomal RNA-processing protein 46

Gene Symbol

EXOSC5

Additional Exosome component 5 Products

Product Documents for Exosome component 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Exosome component 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Exosome component 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Exosome component 5 Antibody - BSA Free and earn rewards!

Have you used Exosome component 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies