Exostosin-like 2/EXTL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56467

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Exostosin-like 2/EXTL2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEM

Reactivity Notes

Mouse 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Exostosin-like 2/EXTL2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Exostosin-like 2/EXTL2 Antibody [NBP2-56467]

Immunocytochemistry/ Immunofluorescence: Exostosin-like 2/EXTL2 Antibody [NBP2-56467]

Immunocytochemistry/Immunofluorescence: Exostosin-like 2/EXTL2 Antibody [NBP2-56467] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.

Applications for Exostosin-like 2/EXTL2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Exostosin-like 2/EXTL2

Exostosin-like 2, or EXTL2 can be found in the extracellular region of the endoplasmic reticulum and is integral to the membrane. Belonging to the glycosyltransferase 47 family, EXTL2 encodes 4-N-acetylhexosamynyltransferase and transfers N-acetylglucosamine to the glycosaminoglycan (GAG) protein linkage region. More specifically, EXTL2 is critical for the synthesis of heparin/heparan sulfate, and the lack of EXTL2 can cause GAG overproduction. Biological processes associated with EXTL2 include the N-acetylglucosamine metabolic process, heparan sulfate proteoglycan biosynthetic process and UDP-N-acetylgalactosamine metabolic process. Known diseases for EXTL2 include Exostosis and hereditary multiple exostoses.

Alternate Names

Exostosin like 2, EXTL2

Gene Symbol

EXTL2

Additional Exostosin-like 2/EXTL2 Products

Product Documents for Exostosin-like 2/EXTL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Exostosin-like 2/EXTL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glycobiology-related Enzymes

Customer Reviews for Exostosin-like 2/EXTL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Exostosin-like 2/EXTL2 Antibody - BSA Free and earn rewards!

Have you used Exostosin-like 2/EXTL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies