EZH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87386

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all EZH1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EZH1. Peptide sequence: DVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EZH1 Antibody - BSA Free

Western Blot: EZH1 Antibody [NBP2-87386]

Western Blot: EZH1 Antibody [NBP2-87386]

Western Blot: EZH1 Antibody [NBP2-87386] - Host: Rabbit. Target Name: EZH1. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for EZH1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EZH1

EZH1 is a human homolog of the Drosophila gene Enhancer of zeste E(z), a member of the polycomb group of transcriptional repressors. In mice, EZH1 is a regulator of homeotic gene expression implicated in the assembly of repressive protein complexes in chromatin. The strong sequence conservation between species suggests potential role for EZH1 in human development as a transcriptional regulator and as a component of protein complexes that stably maintain heterochromatin.

Long Name

Histone-lysine N-methyltransferase EZH1

Alternate Names

EC 2.1.1.356, ENX-2, KIAA0388

Gene Symbol

EZH1

Additional EZH1 Products

Product Documents for EZH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EZH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EZH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EZH1 Antibody - BSA Free and earn rewards!

Have you used EZH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies