FAK (Focal Adhesion Kinase) is a non-receptor protein tyrosine kinase involved in signal transduction from integrin-enriched focal adhesion sites that mediate cell contact with the extracellular matrix. FAK-enhanced signals have been shown to mediate the survival of anchorage-dependent cells and are critical for efficient cell migration in response to growth factor receptor and integrin stimulation. Elevated expression of FAK in human tumors has been correlated with increased malignancy and invasiveness.
FAK Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84750
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Porcine
Cited:
Porcine
Predicted:
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
Reactivity Notes
Porcine reactivity reported in the scientific literature (PMID: 30257480).
Marker
Focal Adhesion Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit FAK Antibody - BSA Free (NBP1-84750) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-FAK Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for FAK Antibody - BSA Free
Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750]
Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.Immunocytochemistry/ Immunofluorescence: FAK Antibody [NBP1-84750]
Immunocytochemistry/Immunofluorescence: FAK Antibody [NBP1-84750] - Staining of human cell line U-2 OS shows localization to cytosol & focal adhesion sites. Antibody staining shown in green.Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750]
Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750]
Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human testis shows moderate to cytoplasmic positivity in spermatogonia and Leydig cells.Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750]
Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.Immunocytochemistry/ Immunofluorescence: FAK Antibody [NBP1-84750] -
Immunocytochemistry/ Immunofluorescence: FAK Antibody [NBP1-84750] - Membrane surface receptor expression & metabolomic analysis of cells grown on porcine breast fatty tissue ECM hydrogel. Integrin beta 1 (a) or beta 4 (b) receptor (green) & FAK (red) expression in MM231 cells cultured on the ECM hydrogel-coated coverslips were assessed by IF. Phalloidin staining (white) of F-actin was used to contour the cells. Scale bars, 10 μm. (c) MS imaging of cross sections of the medium-conditioned blank (upper panels) & MM231 cell culture-laden (bottom panels) hydrogel scaffolds. (d) Examples of ROC (upper) & box-and-whiskers (bottom) plots from the MS imaging analysis, showing data for a compound with m/z 663.024, where differences between the hydrogel samples cultured with or without MM231 cells are clearly evident. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30257480), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for FAK Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: FAK
Long Name
Focal adhesion kinase 1
Alternate Names
FADK1, PTK2
Gene Symbol
PTK2
Additional FAK Products
Product Documents for FAK Antibody - BSA Free
Product Specific Notices for FAK Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for FAK Antibody - BSA Free
Customer Reviews for FAK Antibody - BSA Free
There are currently no reviews for this product. Be the first to review FAK Antibody - BSA Free and earn rewards!
Have you used FAK Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...