FAM107A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54335

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FAM107A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FAM107A(family with sequence similarity 107, member A) The peptide sequence was selected from the middle region of FAM107A. Peptide sequence RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FAM107A Antibody - BSA Free

Western Blot: FAM107A Antibody [NBP1-54335]

Western Blot: FAM107A Antibody [NBP1-54335]

Western Blot: FAM107A Antibody [NBP1-54335] - Transfected 293T cell lysate, concentration 0.0625ug/ml.

Applications for FAM107A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM107A

When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.

Alternate Names

downregulated in renal cell carcinoma, DRR1family with sequence similarity 107 member A transcript, family with sequence similarity 107, member A, FLJ30158, FLJ45473, Protein TU3A, TU3ADown-regulated in renal cell carcinoma 1

Gene Symbol

FAM107A

UniProt

O95990 (Human)

Additional FAM107A Products

Product Documents for FAM107A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FAM107A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FAM107A Antibody - BSA Free

Customer Reviews for FAM107A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAM107A Antibody - BSA Free and earn rewards!

Have you used FAM107A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies