FAM12B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82587

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM12B. Peptide sequence: ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FAM12B Antibody - BSA Free

Western Blot: FAM12B Antibody [NBP2-82587]

Western Blot: FAM12B Antibody [NBP2-82587]

Western Blot: FAM12B Antibody [NBP2-82587] - WB Suggested Anti-EDDM3B Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Applications for FAM12B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM12B

Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg.Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen.Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existingcomponents and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes aresynthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come intocontact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster aresynthesized and secreted by epididymal epithelial cells. (provided by RefSeq)

Alternate Names

epididymal protein 3B, epididymal secretory protein E3 beta, epididymal secretory protein E3-beta, FAM12B, HE3B, HE3-BETA, human epididymis-specific 3 beta, human epididymis-specific protein 3-beta, member B (epididymal), UNQ6412/PRO21187

Gene Symbol

EDDM3B

Additional FAM12B Products

Product Documents for FAM12B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FAM12B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FAM12B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAM12B Antibody - BSA Free and earn rewards!

Have you used FAM12B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...