FANK1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-59799

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FANK1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fank1.
Synthetic peptide located within the following region:
RPHPPVVGKVTHHSIELYWDLEKREKRQGPQEQWLRFSIEEEDPKMHNYG The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, and Rat

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FANK1 Antibody - BSA Free

Western Blot: FANK1 Antibody [NBP2-59799]

Western Blot: FANK1 Antibody [NBP2-59799]

Western Blot: FANK1 Antibody [NBP2-59799] - Host: Rabbit. Target Name: Fank1. Sample Type: Rat pancreas lysates. Antibody Dilution: 1.0ug/ml
Western Blot: FANK1 Antibody [NBP2-59799]

Western Blot: FANK1 Antibody [NBP2-59799]

Western Blot: FANK1 Antibody [NBP2-59799] - Sample Type: Rat pancreas lysates at antibody Dilution of 1.0ug/ml

Applications for FANK1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FANK1

The function of Fank1 remains unknown.

Alternate Names

1700007B22Rik, fibronectin type 3 and ankyrin repeat domains 1, fibronectin type 3 and ankyrin repeat domains protein 1, fibronectin type III and ankyrin repeat domains 1

Gene Symbol

FANK1

Additional FANK1 Products

Product Documents for FANK1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FANK1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FANK1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FANK1 Antibody - BSA Free and earn rewards!

Have you used FANK1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies