Fascin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79776

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Fascin 2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human FSCN2. Peptide sequence AGTLKAGRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Fascin 2 Antibody - BSA Free

Western Blot: Fascin 2 Antibody [NBP1-79776]

Western Blot: Fascin 2 Antibody [NBP1-79776]

Western Blot: Fascin 2 Antibody [NBP1-79776] - analysis of Fascin 2 in NRK whole cell lysate using anti-Fascin 2 antibody. Image from verified customer review.
Western Blot: Fascin 2 Antibody [NBP1-79776]

Western Blot: Fascin 2 Antibody [NBP1-79776]

Western Blot: Fascin 2 Antibody [NBP1-79776] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for Fascin 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 2 reviews rated 4.5 using NBP1-79776 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fascin 2

The Fascin 2 gene encodes a member of the fascin protein family. Fascins crosslink actin into filamentous bundles within dynamic cell extensions. This family member is proposed to play a role in photoreceptor disk morphogenesis. A mutation in this gene results in

Alternate Names

fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotuspurpuratus), fascin-2, Retinal fascin, retinal), RFSNRP30fascin (Strongylocentrotus purpuratus) homolog 2 (actin-bundling protein

Gene Symbol

FSCN2

UniProt

NP_001070650 (Human)

Additional Fascin 2 Products

Product Documents for Fascin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Fascin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fascin 2 Antibody - BSA Free (2)

4.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Fascin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: NRK cells
    Species: Rat
    Verified Customer | Posted 06/05/2015
    Fascin 2 Antibody - BSA Free NBP1-79776
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: Whole cell lysate
    Species: Rat
    Verified Customer | Posted 05/22/2015
    Western Blot of Fascin 2 in NRK cells
    Fascin 2 Antibody - BSA Free NBP1-79776

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies