Fast skeletal myosin light chain 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38544

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Fast skeletal myosin light chain 1 (NP_524146.1).

Sequence:
MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Fast skeletal myosin light chain 1 Antibody - BSA Free

Fast skeletal myosin light chain 1 Antibody

Western Blot: Fast skeletal myosin light chain 1 Antibody [NBP3-38544] -

Western Blot: Fast skeletal myosin light chain 1 Antibody [NBP3-38544] - Western blot analysis of various lysates using Fast skeletal myosin light chain 1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for Fast skeletal myosin light chain 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Fast skeletal myosin light chain 1

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. (provided by RefSeq)

Alternate Names

A1 catalytic, A2 catalytic, MLC1/MLC3, MLC1F, MLC1F/MLC3F, MLC3F, myosin light chain 1/3, skeletal muscle isoform, Myosin light chain A1/A2, Myosin light chain alkali 1/2, myosin, light chain 1, alkali; skeletal, fast, myosin, light polypeptide 1, alkali; skeletal, fast

Gene Symbol

MYL1

Additional Fast skeletal myosin light chain 1 Products

Product Documents for Fast skeletal myosin light chain 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fast skeletal myosin light chain 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fast skeletal myosin light chain 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fast skeletal myosin light chain 1 Antibody - BSA Free and earn rewards!

Have you used Fast skeletal myosin light chain 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...