Fast skeletal myosin light chain 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84926

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Fast skeletal myosin light chain 2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Fast skeletal myosin light chain 2. Peptide sequence: LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Fast skeletal myosin light chain 2 Antibody - BSA Free

Western Blot: Fast skeletal myosin light chain 2 Antibody [NBP2-84926]

Western Blot: Fast skeletal myosin light chain 2 Antibody [NBP2-84926]

Western Blot: Fast skeletal myosin light chain 2 Antibody [NBP2-84926] - WB Suggested Anti-MYLPF Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Applications for Fast skeletal myosin light chain 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fast skeletal myosin light chain 2

MYLPF( AAH12571, 1 a.a. - 170 a.a.) full-length recombinant protein with GST.

Alternate Names

DKFZp779C0757, Fast skeletal myosin light chain 2, HUMMLC2B, MGC13450, MLC2B, MRLC2, MYL11, myosin light chain 2, myosin light chain, phosphorylatable, fast skeletal muscle, myosin regulatory light chain 2, skeletal muscle isoform, myosin, light chain 11, regulatory

Gene Symbol

MYL11

Additional Fast skeletal myosin light chain 2 Products

Product Documents for Fast skeletal myosin light chain 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fast skeletal myosin light chain 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fast skeletal myosin light chain 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fast skeletal myosin light chain 2 Antibody - BSA Free and earn rewards!

Have you used Fast skeletal myosin light chain 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies