FBXO36 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57616

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FBXO36 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FBXO36(F-box protein 36) The peptide sequence was selected from the N terminal of FBXO36. Peptide sequence QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FBXO36 Antibody - BSA Free

Western Blot: FBXO36 Antibody [NBP1-57616]

Western Blot: FBXO36 Antibody [NBP1-57616]

Western Blot: FBXO36 Antibody [NBP1-57616] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for FBXO36 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FBXO36

Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].

Alternate Names

F-box only protein 36, F-box protein 36, Fbx36, FLJ37592, FLJ41090

Gene Symbol

FBXO36

UniProt

Q8NEA4 (Human)

Additional FBXO36 Products

Product Documents for FBXO36 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FBXO36 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FBXO36 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FBXO36 Antibody - BSA Free and earn rewards!

Have you used FBXO36 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies