FBXW12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87436

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FBXW12 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBXW12. Peptide sequence: CASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FBXW12 Antibody - BSA Free

Western Blot: FBXW12 Antibody [NBP2-87436]

Western Blot: FBXW12 Antibody [NBP2-87436]

Western Blot: FBXW12 Antibody [NBP2-87436] - Host: Rabbit. Target Name: FBXW12. Sample Type: Fetal Brain lysates. Antibody Dilution: 1.0ug/ml

Applications for FBXW12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FBXW12

FBXW12, also known as F-box/WD repeat-containing protein 12, has 3 isoforms, a 464 amino acid isoform that is 53 kDa, a 394 amino acid isoform that is 45 kDa and a 445 amino acid isoform that is 51 kDa; ubiquitously expressed, acts as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Little is currently known about this protein disease involvement or interaction with other proteins.

Alternate Names

F-box and WD repeat domain containing 12, F-box and WD-40 domain-containing protein 12, F-box- and WD40-repeat-containing protein, F-box only protein 35MGC120386, F-box/WD repeat-containing protein 12, Fbw12, FBW12MGC120387, FBXO12FBXO35F-box and WD-40 domain protein 12, MGC120385

Gene Symbol

FBXW12

Additional FBXW12 Products

Product Documents for FBXW12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FBXW12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FBXW12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FBXW12 Antibody - BSA Free and earn rewards!

Have you used FBXW12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies