FCER1G Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84930

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FCER1G Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FCER1G. Peptide sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FCER1G Antibody - BSA Free

Western Blot: FCER1G Antibody [NBP2-84930]

Western Blot: FCER1G Antibody [NBP2-84930]

Western Blot: FCER1G Antibody [NBP2-84930] - WB Suggested Anti-FCER1G Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Hela cell lysate

Applications for FCER1G Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FCER1G

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha,1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. (provided by RefSeq)

Alternate Names

Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide, Fc-epsilon RI-gamma, FceRI gamma, FCRG, high affinity immunoglobulin epsilon receptor subunit gamma, IgE Fc receptor subunit gamma, immunoglobulin E receptor, high affinity, gamma chain

Gene Symbol

FCER1G

Additional FCER1G Products

Product Documents for FCER1G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FCER1G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FCER1G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FCER1G Antibody - BSA Free and earn rewards!

Have you used FCER1G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies