Ferritin mitochondrial Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03534

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Ferritin mitochondrial Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 183-242 of human Ferritin mitochondrial (NP_803431.1). DKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Ferritin mitochondrial Antibody - Azide and BSA Free

Western Blot: Ferritin mitochondrial AntibodyAzide and BSA Free [NBP3-03534]

Western Blot: Ferritin mitochondrial AntibodyAzide and BSA Free [NBP3-03534]

Western Blot: Ferritin mitochondrial Antibody [NBP3-03534] - Analysis of extracts of Mouse testis, using Ferritin mitochondrial antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Applications for Ferritin mitochondrial Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Ferritin mitochondrial

Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidaseactivity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation

Alternate Names

EC 1.16.3.1, ferritin H subunit, ferritin mitochondrial, ferritin, mitochondrial, mitochondrial ferritin, MtF

Gene Symbol

FTMT

Additional Ferritin mitochondrial Products

Product Documents for Ferritin mitochondrial Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ferritin mitochondrial Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Ferritin mitochondrial Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Ferritin mitochondrial Antibody - Azide and BSA Free and earn rewards!

Have you used Ferritin mitochondrial Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies