FGF-16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09433

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FGF-16 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGF-16 (NP_003859). Peptide sequence REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit FGF-16 Antibody - BSA Free (NBP3-09433) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for FGF-16 Antibody - BSA Free

Western Blot: FGF-16 Antibody [NBP3-09433]

Western Blot: FGF-16 Antibody [NBP3-09433]

Western Blot: FGF-16 Antibody [NBP3-09433] - Western blot analysis of FGF-16 in MCF7 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Applications for FGF-16 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FGF-16

The protein encoded by the FGF16 gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The rat homolog is predominantly expressed in embryonic brown adipose tissue and has significant mitogenic activity, which suggests a role in proliferation of embryonic brown adipose tissue. [provided by RefSeq]

Long Name

Fibroblast Growth Factor 16

Alternate Names

FGF16

Gene Symbol

FGF16

Additional FGF-16 Products

Product Documents for FGF-16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGF-16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

FGF Family
FGF Ligands

Customer Reviews for FGF-16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FGF-16 Antibody - BSA Free and earn rewards!

Have you used FGF-16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies