FGF basic/FGF2/bFGF Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-21307PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGF basic/FGF2/bFGF

Source: E.coli

Amino Acid Sequence: KGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21307. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-21307PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FGF basic/FGF2/bFGF

FGF basic/FGF2/bFGF is a growth factor that functions in angiogenesis, wound healing, tissue repair, learning and memory, and the morphogenesis of heart, bone, and brain. It is upregulated in response to inflammatory stimuli and in many tumors. FGF basic/FGF2/bFGF binds to FGFR1c and 2c. Its bioactivity is modulated by a number of other binding partners including heparin, Integrin alpha V beta 3, soluble FGFR1, FGF-BP, free gangliosides, Thrombospondin, Pentraxin 3/TSG-14, Fibrinogen, alpha 2-Macroglobulin, PDGF, and CXCL4/PF4. These molecules act as cellular coreceptors or adhesion partners, extracellular matrix decoys or reservoirs, and soluble scavengers or chaperones. In particular, the interaction of FGF basic/FGF2/bFGF with cell surface heparan sulfate proteoglycans (HSPG) is required for the binding and activation of FGF receptors.

Long Name

Fibroblast Growth Factor basic

Alternate Names

bFGF, FGF-2, FGF2, HBGF-2, Prostatropin

Gene Symbol

FGF2

Additional FGF basic/FGF2/bFGF Products

Product Documents for FGF basic/FGF2/bFGF Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGF basic/FGF2/bFGF Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for FGF basic/FGF2/bFGF Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review FGF basic/FGF2/bFGF Recombinant Protein Antigen and earn rewards!

Have you used FGF basic/FGF2/bFGF Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for FGF basic/FGF2/bFGF Recombinant Protein Antigen

Showing  1 - 5 of 6 FAQs Showing All
  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

Showing  1 - 5 of 6 FAQs Showing All
View all FAQs for Proteins and Enzymes