FGF18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84022

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FGF-18 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGF18. Peptide sequence: GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit FGF18 Antibody - BSA Free (NBP2-84022) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for FGF18 Antibody - BSA Free

Western Blot: FGF18 Antibody [NBP2-84022]

Western Blot: FGF18 Antibody [NBP2-84022]

Western Blot: FGF18 Antibody [NBP2-84022] - WB Suggested Anti-FGF18 Antibody. Titration: 1.0 ug/ml. Positive Control: ACHN Whole Cell

Applications for FGF18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FGF-18

FGF18 (fibroblast growth factor 18), belongs to the FGF family which are involved in cell growth, tissue repair, embryonic development and a number of other biological processes. Specifically, FGF18 is crucial for the regulation of cell proliferation, cell differentiation and cell migration. FGF18 is known to have interactions with FGFR2, FGFR1, FGFR3, FGFR4 and FGF1. Disease and disorder research has been conducted in relation to FGF18 and colon cancer, leukemia, melanoma, achondroplasia, cleft lip and carcinoma.

Long Name

Fibroblast Growth Factor 18

Alternate Names

FGF18

Gene Symbol

FGF18

Additional FGF-18 Products

Product Documents for FGF18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGF18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

FGF Family
FGF Ligands

Customer Reviews for FGF18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FGF18 Antibody - BSA Free and earn rewards!

Have you used FGF18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies