FGFR1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-33784PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGFR1.

Source: E. coli

Amino Acid Sequence: LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33784.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-33784PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FGFR1

FGF activity is mediated by a family of type I transmembrane tyrosine kinases, which undergo dimerization and autophosphorylation after ligand binding. Five distinct genes encode closely related FGF receptors, FGFR1 through 5. FGFRs contain three Ig-like domains and a stretch of acidic residues between the first and second Ig-like domains. FGFR1, 2, 3, and -4 have a cytoplasmic split tyrosine-kinase domain, but FGFR5 does not. Multiple forms of FGFR1, 2, and 3 are generated by alternative splicing.

Long Name

Fibroblast Growth Factor Receptor 1

Alternate Names

CD331, FGF R1, Flt-2

Gene Symbol

FGFR1

Additional FGFR1 Products

Product Documents for FGFR1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGFR1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for FGFR1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review FGFR1 Recombinant Protein Antigen and earn rewards!

Have you used FGFR1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for FGFR1 Recombinant Protein Antigen

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I am working in Multiple sclerosis group and mainly working with mice model and cell culture study. I need FGFR1 antibody against Mice for FACS analysis. If it is available can I get the sample to check with my cells? And any Oligodendrocyte markers against mice for FACS too.

    A:

    We do have an antibody that has been tested in FLOW, NB600-1287, however it has not been tested in mouse. If you would like to test this antibody in mouse samples we have an Innovators Reward Program where we reward you for trying our antibody in species and applications that have not been previously tested.

  • Q: I would like to inquire whether you have samples of the following antibodies: NBP1-61338, NB600-1287, NBP1-19481, NBP1-19864; The datasheets for these antibodies show different molecular weights of the detected proteins so its no altogether clear to me which one detects the real protein. To sort this out, we would be using FGFR1-deficient cells and would very much appreciate if you could supply us with small aliquots of these antibodies.

    A: FGFR1 has multiple isoforms and is subject to multiple PTM's. The molecular weight can vary greatly depending on experimental conditions and samples used. We fully guarantee all of our products for the listed applications and species. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Due to our 100% guarantee, we do not offer free of charge samples of our products. If a smaller sample size is available, it will be listed on our product page.

  • Q: I am working in Multiple sclerosis group and mainly working with mice model and cell culture study. I need FGFR1 antibody against Mice for FACS analysis. If it is available can I get the sample to check with my cells? And any Oligodendrocyte markers against mice for FACS too.

    A:

    We do have an antibody that has been tested in FLOW, NB600-1287, however it has not been tested in mouse. If you would like to test this antibody in mouse samples we have an Innovators Reward Program where we reward you for trying our antibody in species and applications that have not been previously tested.

  • Q: I would like to inquire whether you have samples of the following antibodies: NBP1-61338, NB600-1287, NBP1-19481, NBP1-19864; The datasheets for these antibodies show different molecular weights of the detected proteins so its no altogether clear to me which one detects the real protein. To sort this out, we would be using FGFR1-deficient cells and would very much appreciate if you could supply us with small aliquots of these antibodies.

    A: FGFR1 has multiple isoforms and is subject to multiple PTM's. The molecular weight can vary greatly depending on experimental conditions and samples used. We fully guarantee all of our products for the listed applications and species. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Due to our 100% guarantee, we do not offer free of charge samples of our products. If a smaller sample size is available, it will be listed on our product page.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes